GNG5 (NM_005274) Human Mass Spec Standard
CAT#: PH300572
GNG5 MS Standard C13 and N15-labeled recombinant protein (NP_005265)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200572 |
Predicted MW | 7.3 kDa |
Protein Sequence |
>RC200572 protein sequence
Red=Cloning site Green=Tags(s) MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005265 |
RefSeq Size | 823 |
RefSeq ORF | 204 |
Synonyms | FLJ92393 |
Locus ID | 2787 |
UniProt ID | P63218 |
Cytogenetics | 1p22.3 |
Summary | 'G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules (Gilman, 1987 [PubMed 3113327]; summary by Ahmad et al., 1995) [PubMed 7606925].[supplied by OMIM, Nov 2010]' |
Protein Pathways | Chemokine signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417407 | GNG5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417407 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 5 (GNG5) |
USD 396.00 |
|
TP300572 | Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 5 (GNG5) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review