GNG5 (NM_005274) Human Recombinant Protein

CAT#: TP300572

Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 5 (GNG5)

Product Images

Coomassie blue staining of purified GNG5 protein (Cat# TP300572). The protein was produced from HEK293T cells transfected with GNG5 cDNA clone (Cat# RC200572) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200572 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005265
• Locus ID: 2787
• UniProt ID: P63218
• Cytogenetics: 1p22.3
• Refseq Size: 823
• Refseq ORF: 204
• Summary: G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules (Gilman, 1987 [PubMed 3113327]; summary by Ahmad et al., 1995) [PubMed 7606925].[supplied by OMIM, Nov 2010]
• Protein Pathways: Chemokine signaling pathway