GNG5 (NM_005274) Human Recombinant Protein
CAT#: TP300572
Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 5 (GNG5)
View other "GNG5" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200572 protein sequence
Red=Cloning site Green=Tags(s) MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005265 |
Locus ID | 2787 |
UniProt ID | P63218 |
Cytogenetics | 1p22.3 |
Refseq Size | 823 |
Refseq ORF | 204 |
Summary | G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules (Gilman, 1987 [PubMed 3113327]; summary by Ahmad et al., 1995) [PubMed 7606925].[supplied by OMIM, Nov 2010] |
Protein Pathways | Chemokine signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417407 | GNG5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417407 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 5 (GNG5) |
USD 396.00 |
|
PH300572 | GNG5 MS Standard C13 and N15-labeled recombinant protein (NP_005265) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review