RPP20 (POP7) (NM_005837) Human Mass Spec Standard

CAT#: PH300582

POP7 MS Standard C13 and N15-labeled recombinant protein (NP_005828)

Product Images

Coomassie blue staining of purified POP7 protein (Cat# TP300582). The protein was produced from HEK293T cells transfected with POP7 cDNA clone (Cat# RC200582) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200582
• Predicted MW: 15.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200582 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIY
  IHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005828
• RefSeq Size: 949
• RefSeq ORF: 420
• Synonyms: 0610037N12Rik; RPP2; RPP20
• Locus ID: 10248
• UniProt ID: O75817
• Cytogenetics: 7q22.1
• Summary: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP complex, which cleaves pre-rRNA sequences. [UniProtKB/Swiss-Prot Function]
• Protein Families: Stem cell - Pluripotency