RPP20 (POP7) (NM_005837) Human Recombinant Protein
CAT#: TP300582
Recombinant protein of human processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae) (POP7)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200582 protein sequence
Red=Cloning site Green=Tags(s) MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIY IHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 15.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005828 |
Locus ID | 10248 |
UniProt ID | O75817 |
Cytogenetics | 7q22.1 |
Refseq Size | 949 |
Refseq ORF | 420 |
Synonyms | 0610037N12Rik; RPP2; RPP20 |
Summary | Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends (PubMed:9630247, PubMed:30454648). Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences (PubMed:28115465).[UniProtKB/Swiss-Prot Function] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417024 | POP7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY417024 | Transient overexpression lysate of processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae) (POP7) |
USD 325.00 |
|
PH300582 | POP7 MS Standard C13 and N15-labeled recombinant protein (NP_005828) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review