FSTL1 (NM_007085) Human Mass Spec Standard
CAT#: PH300586
FSTL1 MS Standard C13 and N15-labeled recombinant protein (NP_009016)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200586 |
Predicted MW | 35 kDa |
Protein Sequence |
>RC200586 protein sequence
Red=Cloning site Green=Tags(s) MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFS KGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENAD WKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTE EEMTRYVQELQKHQETAEKTKRVSTKEI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_009016 |
RefSeq Size | 3840 |
RefSeq ORF | 924 |
Synonyms | FRP; FSL1; MIR198; OCC-1; OCC1; tsc36 |
Locus ID | 11167 |
UniProt ID | Q12841 |
Cytogenetics | 3q13.33 |
Summary | This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402088 | FSTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402088 | Transient overexpression lysate of follistatin-like 1 (FSTL1) |
USD 396.00 |
|
TP300586 | Recombinant protein of human follistatin-like 1 (FSTL1) |
USD 823.00 |
|
TP720885 | Purified recombinant protein of Human follistatin-like 1 (FSTL1) |
USD 330.00 |
|
TP721119 | Purified recombinant protein of Human follistatin-like 1 (FSTL1) |
USD 330.00 |
|
TP721135 | Purified recombinant protein of Human follistatin-like 1 (FSTL1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review