FSTL1 (NM_007085) Human Mass Spec Standard

CAT#: PH300586

FSTL1 MS Standard C13 and N15-labeled recombinant protein (NP_009016)

Product Images

Coomassie blue staining of purified FSTL1 protein (Cat# TP300586). The protein was produced from HEK293T cells transfected with FSTL1 cDNA clone (Cat# RC200586) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200586
• Predicted MW: 35 kDa
• Protein Sequence:
  Sequence Link

  >RC200586 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG
  KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFS
  KGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENAD
  WKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTE
  EEMTRYVQELQKHQETAEKTKRVSTKEI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009016
• RefSeq Size: 3840
• RefSeq ORF: 924
• Synonyms: FRP; FSL1; MIR198; OCC-1; OCC1; tsc36
• Locus ID: 11167
• UniProt ID: Q12841
• Cytogenetics: 3q13.33
• Summary: This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein