Calumenin (CALU) (NM_001219) Human Mass Spec Standard

CAT#: PH300589

CALU MS Standard C13 and N15-labeled recombinant protein (NP_001210)

Product Images

Coomassie blue staining of purified CALU protein (Cat# TP300589). The protein was produced from HEK293T cells transfected with CALU cDNA clone (Cat# RC200589) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200589
• Predicted MW: 37.1 kDa
• Protein Sequence:
  Sequence Link

  >RC200589 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESK
  ERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDD
  PDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDL
  EEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQN
  KDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001210
• RefSeq Size: 5366
• RefSeq ORF: 945
• Synonyms: FLJ90608
• Locus ID: 813
• UniProt ID: O43852, Q6IAW5, B3KQF5
• Cytogenetics: 7q32.1
• Summary: 'The product of this gene is a calcium-binding protein localized in the endoplasmic reticulum (ER) and it is involved in such ER functions as protein folding and sorting. This protein belongs to a family of multiple EF-hand proteins (CERC) that include reticulocalbin, ERC-55, and Cab45 and the product of this gene. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008]'
• Protein Families: Secreted Protein