FH (NM_000143) Human Mass Spec Standard
CAT#: PH300614
FH MS Standard C13 and N15-labeled recombinant protein (NP_000134)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200614 |
Predicted MW | 54.6 kDa |
Protein Sequence |
>RC200614 protein sequence
Red=Cloning site Green=Tags(s) MYRALRLLARSRPLVRAPAAALASAPGLGGAAVPSFWPPNAARMASQNSFRIEYDTFGELKVPNDKYYGA QTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVV WQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPG LQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVG TGLNTRIGFAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPR SGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSA RLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELG YLTAEQFDEWVKPKDMLGPK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000134 |
RefSeq Size | 1877 |
RefSeq ORF | 1530 |
Synonyms | FMRD; HLRCC; HsFH; LRCC; MCL; MCUL1 |
Locus ID | 2271 |
UniProt ID | P07954, A0A0S2Z4C3 |
Cytogenetics | 1q43 |
Summary | 'The protein encoded by this gene is an enzymatic component of the tricarboxylic acid (TCA) cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Citrate cycle (TCA cycle), Metabolic pathways, Pathways in cancer, Renal cell carcinoma |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400053 | FH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400053 | Transient overexpression lysate of fumarate hydratase (FH), nuclear gene encoding mitochondrial protein |
USD 325.00 |
|
TP300614 | Recombinant protein of human fumarate hydratase (FH), nuclear gene encoding mitochondrial protein |
USD 823.00 |
|
TP720199 | Recombinant protein of human fumarate hydratase (FH), nuclear gene encoding mitochondrial protein |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review