Epoxide hydrolase (EPHX1) (NM_000120) Human Mass Spec Standard

CAT#: PH300621

EPHX1 MS Standard C13 and N15-labeled recombinant protein (NP_000111)

Product Images

Coomassie blue staining of purified EPHX1 protein (Cat# TP300621). The protein was produced from HEK293T cells transfected with EPHX1 cDNA clone (Cat# RC200621) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200621
• Predicted MW: 52.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200621 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKF
  RFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHT
  PKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYK
  LMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVE
  LLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFS
  LDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKL
  ISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000111
• RefSeq Size: 1847
• RefSeq ORF: 1365
• Synonyms: EPHX; EPOX; HYL1; MEH
• Locus ID: 2052
• UniProt ID: P07099, R4SBI6
• Cytogenetics: 1q42.12
• Summary: 'Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2008]'
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Metabolism of xenobiotics by cytochrome P450