BCAT2 (NM_001190) Human Mass Spec Standard

CAT#: PH300625

BCAT2 MS Standard C13 and N15-labeled recombinant protein (NP_001181)

Product Images

Coomassie blue staining of purified BCAT2 protein (Cat# TP300625). The protein was produced from HEK293T cells transfected with BCAT2 cDNA clone (Cat# RC200625) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200625
• Predicted MW: 44.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200625 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEW
  NDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFD
  KLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPTRALLFVILCPVGAYFPGGSVTPVS
  LLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGV
  LELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRI
  LYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001181
• RefSeq Size: 1616
• RefSeq ORF: 1176
• Synonyms: BCAM; BCATM; BCT2; PP18
• Locus ID: 587
• UniProt ID: O15382
• Cytogenetics: 19q13.33
• Summary: 'This gene encodes a branched chain aminotransferase found in mitochondria. The encoded protein forms a dimer that catalyzes the first step in the production of the branched chain amino acids leucine, isoleucine, and valine. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]'
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Pantothenate and CoA biosynthesis, Valine, leucine and isoleucine biosynthesis, Valine, leucine and isoleucine degradation