BAD (NM_004322) Human Mass Spec Standard
CAT#: PH300634
BAD MS Standard C13 and N15-labeled recombinant protein (NP_004313)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200634 |
| Predicted MW | 18.2 kDa |
| Protein Sequence |
>RC200634 representing NM_004322
Red=Cloning site Green=Tags(s) MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIR SRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQ MRQSSSWTRVFQSWWDRNLGRGSSAPSQ myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_004313 |
| RefSeq Size | 1127 |
| RefSeq ORF | 504 |
| Synonyms | BBC2; BCL2L8 |
| Locus ID | 572 |
| UniProt ID | Q92934, A0A024R562 |
| Cytogenetics | 11q13.1 |
| Summary | 'The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL (B-cell lymphoma-extra large) and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq, Dec 2019]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Acute myeloid leukemia, Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Insulin signaling pathway, Melanoma, Neurotrophin signaling pathway, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, VEGF signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403214 | BAD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC418067 | BAD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429193 | BAD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403214 | Transient overexpression lysate of BCL2-associated agonist of cell death (BAD), transcript variant 2 |
USD 436.00 |
|
| LY418067 | Transient overexpression lysate of BCL2-associated agonist of cell death (BAD), transcript variant 1 |
USD 436.00 |
|
| LY429193 | Transient overexpression lysate of BCL2-associated agonist of cell death (BAD), transcript variant 1 |
USD 396.00 |
|
| TP300634 | Recombinant protein of human BCL2-associated agonist of cell death (BAD), transcript variant 1 |
USD 823.00 |
|
| TP760222 | Recombinant protein of human BCL2-associated agonist of cell death (BAD), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China