NNMT (NM_006169) Human Mass Spec Standard
CAT#: PH300641
NNMT MS Standard C13 and N15-labeled recombinant protein (NP_006160)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200641 |
Predicted MW | 29.6 kDa |
Protein Sequence |
>RC200641 protein sequence
Red=Cloning site Green=Tags(s) MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQ LLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLK CDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQK FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006160 |
RefSeq Size | 1579 |
RefSeq ORF | 792 |
Synonyms | nicotinamide N-methyltransferase |
Locus ID | 4837 |
UniProt ID | P40261, Q6FH49 |
Cytogenetics | 11q23.2 |
Summary | 'N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. [provided by RefSeq, Jul 2008]' |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401860 | NNMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401860 | Transient overexpression lysate of nicotinamide N-methyltransferase (NNMT) |
USD 396.00 |
|
TP300641 | Recombinant protein of human nicotinamide N-methyltransferase (NNMT) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review