NNMT (NM_006169) Human Recombinant Protein
CAT#: TP300641
Recombinant protein of human nicotinamide N-methyltransferase (NNMT)
View other "NNMT" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 379.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200641 protein sequence
Red=Cloning site Green=Tags(s) MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQ LLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLK CDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQK FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006160 |
Locus ID | 4837 |
UniProt ID | P40261, Q6FH49 |
Cytogenetics | 11q23.2 |
Refseq Size | 1579 |
Refseq ORF | 792 |
Summary | N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. [provided by RefSeq, Jul 2008] |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401860 | NNMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401860 | Transient overexpression lysate of nicotinamide N-methyltransferase (NNMT) |
USD 396.00 |
|
PH300641 | NNMT MS Standard C13 and N15-labeled recombinant protein (NP_006160) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review