Emerin (EMD) (NM_000117) Human Mass Spec Standard

CAT#: PH300643

EMD MS Standard C13 and N15-labeled recombinant protein (NP_000108)

Product Images

Coomassie blue staining of purified EMD protein (Cat# TP300643). The protein was produced from HEK293T cells transfected with EMD cDNA clone (Cat# RC200643) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200643
• Predicted MW: 29 kDa
• Protein Sequence:
  Sequence Link

  >RC200643 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYSFSDLNSTRGD
  ADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFPDADAFHHQVHDDDLL
  SSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLSYYPTSSSTSFMSSSSSSSSWLTRRAIRPEN
  RAPGAGLGQDRQVPLWGQLLLFLVFVIVLFFIYHFMQAEEGNPF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000108
• RefSeq Size: 1370
• RefSeq ORF: 762
• Synonyms: EDMD; LEMD5; STA
• Locus ID: 2010
• UniProt ID: P50402
• Cytogenetics: Xq28
• Summary: 'Emerin is a serine-rich nuclear membrane protein and a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Dreifuss-Emery muscular dystrophy is an X-linked inherited degenerative myopathy resulting from mutation in the emerin gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)