POLR2H (NM_006232) Human Mass Spec Standard
CAT#: PH300650
POLR2H MS Standard C13 and N15-labeled recombinant protein (NP_006223)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200650 |
Predicted MW | 17.1 kDa |
Protein Sequence |
>RC200650 protein sequence
Red=Cloning site Green=Tags(s) MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTL DDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSR VYLLMKKLAF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006223 |
RefSeq Size | 1264 |
RefSeq ORF | 450 |
Synonyms | RPABC3; RPB8; RPB17 |
Locus ID | 5437 |
UniProt ID | P52434 |
Cytogenetics | 3q27.1 |
Summary | 'The three eukaryotic RNA polymerases are complex multisubunit enzymes that play a central role in the transcription of nuclear genes. This gene encodes an essential and highly conserved subunit of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]' |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416788 | POLR2H HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY416788 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide H (POLR2H) |
USD 325.00 |
|
TP300650 | Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review