POLR2H (NM_006232) Human Recombinant Protein

CAT#: TP300650

Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H)

Product Images

Coomassie blue staining of purified POLR2H protein (Cat# TP300650). The protein was produced from HEK293T cells transfected with POLR2H cDNA clone (Cat# RC200650) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200650 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTL
  DDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSR
  VYLLMKKLAF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006223
• Locus ID: 5437
• UniProt ID: P52434
• Cytogenetics: 3q27.1
• Refseq Size: 1264
• Refseq ORF: 450
• Synonyms: RPABC3; RPB8; RPB17
• Summary: The three eukaryotic RNA polymerases are complex multisubunit enzymes that play a central role in the transcription of nuclear genes. This gene encodes an essential and highly conserved subunit of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013]
• Protein Families: Transcription Factors
• Protein Pathways: Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase