Syntaxin 3 (STX3) (NM_004177) Human Mass Spec Standard
CAT#: PH300658
STX3 MS Standard C13 and N15-labeled recombinant protein (NP_004168)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200658 |
Predicted MW | 33.2 kDa |
Protein Sequence |
>RC200658 protein sequence
Red=Cloning site Green=Tags(s) MKDRLEQLKAKQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPE PKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVD FRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKDIVRLESSIKE LHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKARDETKKAVKYQSQARKKLIIIIVLVVVLLGILAL IIGLSVGLN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004168 |
RefSeq Size | 6498 |
RefSeq ORF | 867 |
Synonyms | STX3A |
Locus ID | 6809 |
UniProt ID | Q13277, Q53YE2 |
Cytogenetics | 11q12.1 |
Summary | The gene is a member of the syntaxin family. The encoded protein is targeted to the apical membrane of epithelial cells where it forms clusters and is important in establishing and maintaining polarity necessary for protein trafficking involving vesicle fusion and exocytosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418166 | STX3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC432811 | STX3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418166 | Transient overexpression lysate of syntaxin 3 (STX3) |
USD 396.00 |
|
LY432811 | Transient overexpression lysate of syntaxin 3 (STX3), transcript variant 2 |
USD 396.00 |
|
TP300658 | Recombinant protein of human syntaxin 3 (STX3) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review