FKBP1B (NM_054033) Human Mass Spec Standard

CAT#: PH300667

FKBP1B MS Standard C13 and N15-labeled recombinant protein (NP_473374)

Product Images

Coomassie blue staining of purified FKBP1B protein (Cat# TP300667). The protein was produced from HEK293T cells transfected with FKBP1B cDNA clone (Cat# RC200667) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200667
• Predicted MW: 8.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200667 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPL
  SPLPICPHPC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_473374
• RefSeq Size: 1016
• RefSeq ORF: 240
• Synonyms: FKBP1L; FKBP12.6; OTK4; PKBP1L; PPIase
• Locus ID: 2281
• UniProt ID: P68106
• Cytogenetics: 2p23.3
• Summary: 'The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome