FKBP1B (NM_054033) Human Mass Spec Standard
CAT#: PH300667
FKBP1B MS Standard C13 and N15-labeled recombinant protein (NP_473374)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200667 |
Predicted MW | 8.8 kDa |
Protein Sequence |
>RC200667 protein sequence
Red=Cloning site Green=Tags(s) MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPL SPLPICPHPC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_473374 |
RefSeq Size | 1016 |
RefSeq ORF | 240 |
Synonyms | FKBP1L; FKBP12.6; OTK4; PKBP1L; PPIase |
Locus ID | 2281 |
UniProt ID | P68106 |
Cytogenetics | 2p23.3 |
Summary | 'The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409277 | FKBP1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409277 | Transient overexpression lysate of FK506 binding protein 1B, 12.6 kDa (FKBP1B), transcript variant 2 |
USD 396.00 |
|
TP300667 | Recombinant protein of human FK506 binding protein 1B, 12.6 kDa (FKBP1B), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review