FKBP1B (NM_054033) Human Recombinant Protein
CAT#: TP300667
Recombinant protein of human FK506 binding protein 1B, 12.6 kDa (FKBP1B), transcript variant 2
View other "FKBP1B" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200667 protein sequence
Red=Cloning site Green=Tags(s) MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPL SPLPICPHPC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_473374 |
Locus ID | 2281 |
UniProt ID | P68106 |
Cytogenetics | 2p23.3 |
Refseq Size | 1016 |
Refseq ORF | 240 |
Synonyms | FKBP1L; FKBP12.6; OTK4; PKBP1L; PPIase |
Summary | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409277 | FKBP1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409277 | Transient overexpression lysate of FK506 binding protein 1B, 12.6 kDa (FKBP1B), transcript variant 2 |
USD 396.00 |
|
PH300667 | FKBP1B MS Standard C13 and N15-labeled recombinant protein (NP_473374) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review