NAGA (NM_000262) Human Mass Spec Standard

CAT#: PH300707

NAGA MS Standard C13 and N15-labeled recombinant protein (NP_000253)

Product Images

Coomassie blue staining of purified NAGA protein (Cat# TP300707). The protein was produced from HEK293T cells transfected with NAGA cDNA clone (Cat# RC200707) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200707
• Predicted MW: 46.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200707 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLLKTVLLLGHVAQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDM
  GYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQ
  DAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICN
  LWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPL
  LMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYR
  YHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000253
• RefSeq Size: 3726
• RefSeq ORF: 1233
• Synonyms: D22S674; GALB
• Locus ID: 4668
• UniProt ID: P17050, A0A024R1Q5
• Cytogenetics: 22q13.2
• Summary: 'NAGA encodes the lysosomal enzyme alpha-N-acetylgalactosaminidase, which cleaves alpha-N-acetylgalactosaminyl moieties from glycoconjugates. Mutations in NAGA have been identified as the cause of Schindler disease types I and II (type II also known as Kanzaki disease). [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Glycosphingolipid biosynthesis - globo series, Lysosome