ALDH1A1 (NM_000689) Human Mass Spec Standard
CAT#: PH300723
ALDH1A1 MS Standard C13 and N15-labeled recombinant protein (NP_000680)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200723 |
Predicted MW | 54.7 kDa |
Protein Sequence |
>RC200723 representing NM_000689
Red=Cloning site Green=Tags(s) MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQA FQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKI QGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIK EAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLA DADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ YDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVK TVTVKISQKNS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000680 |
RefSeq Size | 2116 |
RefSeq ORF | 1503 |
Synonyms | ALDC; ALDH-E1; ALDH1; ALDH11; HEL-9; HEL-S-53e; HEL12; PUMB1; RALDH1 |
Locus ID | 216 |
UniProt ID | P00352, V9HW83 |
Cytogenetics | 9q21.13 |
Summary | 'The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet. [provided by RefSeq, Mar 2011]' |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Protein Pathways | Metabolic pathways, Retinol metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400230 | ALDH1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400230 | Transient overexpression lysate of aldehyde dehydrogenase 1 family, member A1 (ALDH1A1) |
USD 325.00 |
|
TP300723 | Recombinant protein of human aldehyde dehydrogenase 1 family, member A1 (ALDH1A1) |
USD 823.00 |
|
TP720901 | Purified recombinant protein of Human aldehyde dehydrogenase 1 family, member A1 (ALDH1A1) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review