SOX2 (NM_003106) Human Mass Spec Standard

CAT#: PH300757

SOX2 MS Standard C13 and N15-labeled recombinant protein (NP_003097)

Product Images

Coomassie blue staining of purified SOX2 protein (Cat# TP300757). The protein was produced from HEK293T cells transfected with SOX2 cDNA clone (Cat# RC200757) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200757
• Predicted MW: 34.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200757 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSE
  ISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA
  SGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSM
  TSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPG
  AEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003097
• RefSeq Size: 2520
• RefSeq ORF: 951
• Synonyms: ANOP3; MCOPS3
• Locus ID: 6657
• UniProt ID: P48431, A0A0U3FYV6
• Cytogenetics: 3q26.33
• Summary: 'This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT). [provided by RefSeq, Jul 2008]'
• Protein Families: Adult stem cells, Cancer stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors