C11orf48 (LBHD1) (NM_024099) Human Mass Spec Standard

CAT#: PH300782

C11orf48 MS Standard C13 and N15-labeled recombinant protein (NP_077004)

Product Images

Coomassie blue staining of purified LBHD1 protein (Cat# TP300782). The protein was produced from HEK293T cells transfected with LBHD1 cDNA clone (Cat# RC200782) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200782
• Predicted MW: 28.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200782 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALVPGRSKEDGLWTRNSPGSSQHPESPRLPNPLWDRGKIGKVEGHQHIQDFSQKSHLPSIVVESSEVNE
  ESGDLHLPHEELLLLTDGEEEDAEAFFQDQSEEPGWAWSPQDPRSPLRTFNAGLSWGQDQDEEDACWILE
  DTACLEATNHCPFWDSTGSRVCRSGFVEYSHLLPPNSFEGAEEEAVQTPAGVESGAASEAPGGRGCDRPR
  ADHAAPPQEAGVQCTCQHYTVREEAQKTPPADPACPEREDSHGSGSPFKASQD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_077004
• RefSeq Size: 1357
• RefSeq ORF: 789
• Synonyms: C11orf48
• Locus ID: 79081
• UniProt ID: Q9BQE6, A0A024R584
• Cytogenetics: 11q12.3
• Summary: This gene shares three exons in common with another gene, chromosome 11 open reading frame 98 (GeneID:102288414), but the encoded protein uses a reading frame that is different from that of the chromosome 11 open reading frame 98 gene. [provided by RefSeq, Nov 2017]