CDCA3 (NM_031299) Human Mass Spec Standard

CAT#: PH300821

CDCA3 MS Standard C13 and N15-labeled recombinant protein (NP_112589)

Product Images

Coomassie blue staining of purified CDCA3 protein (Cat# TP300821). The protein was produced from HEK293T cells transfected with CDCA3 cDNA clone (Cat# RC200821) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200821
• Predicted MW: 29 kDa
• Protein Sequence:
  Sequence Link

  >RC200821 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKHAQDSDPRSPT
  LGIARTPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSSELDLPLGTQLSVEEQMPPWN
  QTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSP
  GTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_112589
• RefSeq Size: 1944
• RefSeq ORF: 804
• Synonyms: GRCC8; TOME-1
• Locus ID: 83461
• UniProt ID: Q99618
• Cytogenetics: 12p13.31
• Summary: F-box-like protein which is required for entry into mitosis. Acts by participating in E3 ligase complexes that mediate the ubiquitination and degradation of WEE1 kinase at G2/M phase. [UniProtKB/Swiss-Prot Function]