PECR (NM_018441) Human Mass Spec Standard

CAT#: PH300822

PECR MS Standard C13 and N15-labeled recombinant protein (NP_060911)

Product Images

Coomassie blue staining of purified PECR protein (Cat# TP300822). The protein was produced from HEK293T cells transfected with PECR cDNA clone (Cat# RC200822) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200822
• Predicted MW: 32.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200822 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTK
  QARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCK
  AVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAV
  ENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNW
  PKGAGDLSVVKKMKETFKEKAKL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060911
• RefSeq Size: 1874
• RefSeq ORF: 909
• Synonyms: DCRRP; HPDHASE; HSA250303; PVIARL; SDR29C1; TERP
• Locus ID: 55825
• UniProt ID: Q9BY49
• Cytogenetics: 2q35
• Summary: Participates in chain elongation of fatty acids. Has no 2,4-dienoyl-CoA reductase activity. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Biosynthesis of unsaturated fatty acids