KATNAL1 (NM_032116) Human Mass Spec Standard
CAT#: PH300828
KATNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_115492)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200828 |
Predicted MW | 55.4 kDa |
Protein Sequence |
>RC200828 protein sequence
Red=Cloning site Green=Tags(s) MNLAEICDNAKKGREYALLGNYDSSMVYYQGVMQQIQRHCQSVRDPAIKGKWQQVRQELLEEYEQVKSIV STLESFKIDKPPDFPVSCQDEPFRDPAVWPPPVPAEHRAPPQIRRPNREVRPLRKEMAGVGARGPVGRAH PISKSEKPSTSRDKDYRARGRDDKGRKNMQDGASDGEMPKFDGAGYDKDLVEALERDIVSRNPSIHWDDI ADLEEAKKLLREAVVLPMWMPDFFKGIRRPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSK YRGESEKLVRLLFEMARFYAPTTIFIDEIDSICSRRGTSDEHEASRRVKSELLIQMDGVGGALENDDPSK MVMVLAATNFPWDIDEALRRRLEKRIYIPLPTAKGRAELLKINLREVELDPDIQLEDIAEKIEGYSGADI TNVCRDASLMAMRRRINGLSPEEIRALSKEELQMPVTKGDFELALKKIAKSVSAADLEKYEKWMVEFGSA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115492 |
RefSeq Size | 7554 |
RefSeq ORF | 1470 |
Synonyms | MGC2599 |
Locus ID | 84056 |
UniProt ID | Q9BW62, A0A024RDP8 |
Cytogenetics | 13q12.3 |
Summary | Regulates microtubule dynamics in Sertoli cells, a process that is essential for spermiogenesis and male fertility. Severs microtubules in an ATP-dependent manner, promoting rapid reorganization of cellular microtubule arrays (By similarity). Has microtubule-severing activity in vitro (PubMed:26929214). [UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403145 | KATNAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423055 | KATNAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425357 | KATNAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403145 | Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 1 |
USD 396.00 |
|
LY423055 | Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 2 |
USD 605.00 |
|
LY425357 | Transient overexpression lysate of katanin p60 subunit A-like 1 (KATNAL1), transcript variant 2 |
USD 396.00 |
|
PH320944 | KATNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_001014402) |
USD 2,055.00 |
|
TP300828 | Recombinant protein of human katanin p60 subunit A-like 1 (KATNAL1), transcript variant 1 |
USD 867.00 |
|
TP320944 | Recombinant protein of human katanin p60 subunit A-like 1 (KATNAL1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review