PLPBP (NM_007198) Human Mass Spec Standard
CAT#: PH300853
PROSC MS Standard C13 and N15-labeled recombinant protein (NP_009129)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200853 |
Predicted MW | 30.3 kDa |
Protein Sequence |
>RC200853 protein sequence
Red=Cloning site Green=Tags(s) MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYV QELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSVKLADKVNSSWQRKGSPERLK VMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLREELCK KLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAADVKAPLEVAQEH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_009129 |
RefSeq Size | 2586 |
RefSeq ORF | 825 |
Synonyms | EPVB6D; PROSC |
Locus ID | 11212 |
UniProt ID | O94903 |
Cytogenetics | 8p11.23 |
Summary | This gene encodes a pyridoxal 5'-phosphate binding protein involved in the homeostatic regulation of intracellular pyridoxal 5'-phosphate. This gene has a tumor suppressive effect on hepatocellular carcinoma and other solid tumors of epithelial origin. Naturally occurring mutations in this gene are associated with a pyridoxine-dependent epilepsy. [provided by RefSeq, Mar 2017] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416132 | PROSC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416132 | Transient overexpression lysate of proline synthetase co-transcribed homolog (bacterial) (PROSC) |
USD 396.00 |
|
TP300853 | Recombinant protein of human proline synthetase co-transcribed homolog (bacterial) (PROSC) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review