PLPBP (NM_007198) Human Mass Spec Standard

CAT#: PH300853

PROSC MS Standard C13 and N15-labeled recombinant protein (NP_009129)

Product Images

Coomassie blue staining of purified PLPBP protein (Cat# TP300853). The protein was produced from HEK293T cells transfected with PLPBP cDNA clone (Cat# RC200853) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200853
• Predicted MW: 30.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200853 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYV
  QELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSVKLADKVNSSWQRKGSPERLK
  VMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLREELCK
  KLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAADVKAPLEVAQEH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009129
• RefSeq Size: 2586
• RefSeq ORF: 825
• Synonyms: EPVB6D; PROSC
• Locus ID: 11212
• UniProt ID: O94903
• Cytogenetics: 8p11.23
• Summary: This gene encodes a pyridoxal 5'-phosphate binding protein involved in the homeostatic regulation of intracellular pyridoxal 5'-phosphate. This gene has a tumor suppressive effect on hepatocellular carcinoma and other solid tumors of epithelial origin. Naturally occurring mutations in this gene are associated with a pyridoxine-dependent epilepsy. [provided by RefSeq, Mar 2017]