URM1 (NM_030914) Human Mass Spec Standard
CAT#: PH300854
URM1 MS Standard C13 and N15-labeled recombinant protein (NP_112176)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200854 |
Predicted MW | 11.4 kDa |
Protein Sequence |
>RC200854 protein sequence
Red=Cloning site Green=Tags(s) MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVL INDADWELLGELDYQLQDQDSVLFISTLHGG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_112176 |
RefSeq Size | 2650 |
RefSeq ORF | 303 |
Synonyms | C9orf74 |
Locus ID | 81605 |
UniProt ID | Q9BTM9, A0A024R8C7 |
Cytogenetics | 9q34.11 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410664 | URM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410664 | Transient overexpression lysate of ubiquitin related modifier 1 homolog (S. cerevisiae) (URM1), transcript variant 1 |
USD 396.00 |
|
TP300854 | Recombinant protein of human ubiquitin related modifier 1 homolog (S. cerevisiae) (URM1), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review