DNA Polymerase epsilon (POLE3) (NM_017443) Human Mass Spec Standard

CAT#: PH300874

POLE3 MS Standard C13 and N15-labeled recombinant protein (NP_059139)

Product Images

Coomassie blue staining of purified POLE3 protein (Cat# TP300874). The protein was produced from HEK293T cells transfected with POLE3 cDNA clone (Cat# RC200874) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200874
• Predicted MW: 16.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200874 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVL
  SAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQN
  EEEEVDN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_059139
• RefSeq Size: 2288
• RefSeq ORF: 441
• Synonyms: CHARAC17; CHRAC2; CHRAC17; p17; YBL1
• Locus ID: 54107
• UniProt ID: Q9NRF9, A0A024R829
• Cytogenetics: 9q32
• Summary: POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. [supplied by OMIM, Apr 2004]
• Protein Pathways: Base excision repair, DNA replication, Metabolic pathways, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism