DNA Polymerase epsilon (POLE3) (NM_017443) Human Recombinant Protein
CAT#: TP300874
Recombinant protein of human polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3)
View other "POLE3" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200874 protein sequence
Red=Cloning site Green=Tags(s) MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVL SAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQN EEEEVDN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_059139 |
Locus ID | 54107 |
UniProt ID | Q9NRF9, A0A024R829 |
Cytogenetics | 9q32 |
Refseq Size | 2288 |
Refseq ORF | 441 |
Synonyms | CHARAC17; CHRAC2; CHRAC17; p17; YBL1 |
Summary | POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM, Apr 2004] |
Protein Pathways | Base excision repair, DNA replication, Metabolic pathways, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413749 | POLE3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413749 | Transient overexpression lysate of polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3) |
USD 396.00 |
|
PH300874 | POLE3 MS Standard C13 and N15-labeled recombinant protein (NP_059139) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review