NMNAT2 (NM_170706) Human Mass Spec Standard
CAT#: PH300889
NMNAT2 MS Standard C13 and N15-labeled recombinant protein (NP_733820)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200889 |
Predicted MW | 34 kDa |
Protein Sequence |
>RC200889 protein sequence
Red=Cloning site Green=Tags(s) MEIQELEEIQACQGLWEVFVTLSERARDYLHKTGRFIVIGGIVSPVHDSYGKQGLVSSRHRLIMCQLAVQ NSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTPSMTPVIGQPQNETPQPIYQNSNVAT KPTAAKILGKVGESLSRICCVRPPVERFTFVDENANLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNE ADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVV DYLSQPVIDYILKSQLYINASG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_733820 |
RefSeq Size | 5467 |
RefSeq ORF | 906 |
Synonyms | C1orf15; PNAT2 |
Locus ID | 23057 |
UniProt ID | Q9BZQ4 |
Cytogenetics | 1q25.3 |
Summary | This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus, and is ubiquitously expressed; this enzyme is cytoplasmic, and is predominantly expressed in the brain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406885 | NMNAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC414841 | NMNAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406885 | Transient overexpression lysate of nicotinamide nucleotide adenylyltransferase 2 (NMNAT2), transcript variant 2 |
USD 396.00 |
|
LY414841 | Transient overexpression lysate of nicotinamide nucleotide adenylyltransferase 2 (NMNAT2), transcript variant 1 |
USD 396.00 |
|
TP300889 | Recombinant protein of human nicotinamide nucleotide adenylyltransferase 2 (NMNAT2), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review