DPCD (NM_015448) Human Mass Spec Standard

CAT#: PH300890

DPCD MS Standard C13 and N15-labeled recombinant protein (NP_056263)

Product Images

Coomassie blue staining of purified DPCD protein (Cat# TP300890). The protein was produced from HEK293T cells transfected with DPCD cDNA clone (Cat# RC200890) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200890
• Predicted MW: 23.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200890 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGD
  PAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKF
  SIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056263
• RefSeq Size: 858
• RefSeq ORF: 609
• Synonyms: RP11-529I10.4
• Locus ID: 25911
• UniProt ID: Q9BVM2
• Cytogenetics: 10q24.32
• Summary: This gene in mouse encodes a protein that may be involved in the generation and maintenance of ciliated cells. In mouse, expression of this gene increases during ciliated cell differentiation, and disruption of this gene has been linked to primary ciliary dyskinesia. [provided by RefSeq, Jul 2016]