CDC20 (NM_001255) Human Mass Spec Standard

CAT#: PH300911

CDC20 MS Standard C13 and N15-labeled recombinant protein (NP_001246)

Product Images

Coomassie blue staining of purified CDC20 protein (Cat# TP300911). The protein was produced from HEK293T cells transfected with CDC20 cDNA clone (Cat# RC200911) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200911
• Predicted MW: 54.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200911 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTT
  PSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNA
  PEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWS
  ASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYI
  LSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQT
  FTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGF
  AQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAK
  SSLIHQGIR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001246
• RefSeq Size: 1697
• RefSeq ORF: 1497
• Synonyms: bA276H19.3; CDC20A; p55CDC
• Locus ID: 991
• UniProt ID: Q12834
• Cytogenetics: 1p34.2
• Summary: 'CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle. It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Oocyte meiosis, Ubiquitin mediated proteolysis