DARPP32 (PPP1R1B) (NM_181505) Human Mass Spec Standard

CAT#: PH300916

PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_852606)

Product Images

Coomassie blue staining of purified PPP1R1B protein (Cat# TP300916). The protein was produced from HEK293T cells transfected with PPP1R1B cDNA clone (Cat# RC200916) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200916
• Predicted MW: 18.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200916 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEED
  ELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDG
  GSEDQVEDPALSEPGEEPQRPSPSEPGT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_852606
• RefSeq Size: 1530
• RefSeq ORF: 504
• Synonyms: DARPP-32; DARPP32
• Locus ID: 84152
• UniProt ID: Q9UD71, A0A024R1R3
• Cytogenetics: 17q12
• Summary: This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
• Protein Families: Druggable Genome