EFHD1 (NM_025202) Human Mass Spec Standard

CAT#: PH300956

EFHD1 MS Standard C13 and N15-labeled recombinant protein (NP_079478)

Product Images

Coomassie blue staining of purified EFHD1 protein (Cat# TP300956). The protein was produced from HEK293T cells transfected with EFHD1 cDNA clone (Cat# RC200956) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200956
• Predicted MW: 26.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200956 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAA
  RPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDE
  DFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELK
  AEQDERKREEEERRLRQAAFQKLKANFNT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079478
• RefSeq Size: 2000
• RefSeq ORF: 717
• Synonyms: MST133; MSTP133; PP3051; SWS2
• Locus ID: 80303
• UniProt ID: Q9BUP0
• Cytogenetics: 2q37.1
• Summary: This gene encodes a member of the EF-hand super family of calcium binding proteins, which are involved in a variety of cellular processes including mitosis, synaptic transmission, and cytoskeletal rearrangement. The protein encoded by this gene is composed of an N-terminal disordered region, proline-rich elements, two EF-hands, and a C-terminal coiled-coil domain. This protein has been shown to associate with the mitochondrial inner membrane, and in HeLa cells, acts as a novel mitochondrial calcium ion sensor for mitochondrial flash activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]