GRHPR (NM_012203) Human Mass Spec Standard

CAT#: PH300963

GRHPR MS Standard C13 and N15-labeled recombinant protein (NP_036335)

Product Images

Coomassie blue staining of purified GRHPR protein (Cat# TP300963). The protein was produced from HEK293T cells transfected with GRHPR cDNA clone (Cat# RC200963) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200963
• Predicted MW: 35.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200963 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDA
  AGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTS
  WKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSD
  FIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNH
  PLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036335
• RefSeq Size: 1235
• RefSeq ORF: 984
• Synonyms: GLXR; GLYD; PH2
• Locus ID: 9380
• UniProt ID: Q9UBQ7, A0A384N605
• Cytogenetics: 9p13.2
• Summary: This gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Pyruvate metabolism