TGF beta 1 (TGFB1) (NM_000660) Human Mass Spec Standard
CAT#: PH300973
TGFB1 MS Standard C13 and N15-labeled recombinant protein (NP_000651)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200973 |
| Predicted MW | 44.3 kDa |
| Protein Sequence |
>RC200973 protein sequence
Red=Cloning site Green=Tags(s) MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPP GPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSEL REAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSR GGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRAL DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGA SAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000651 |
| RefSeq Size | 2583 |
| RefSeq ORF | 1170 |
| Synonyms | CED; DPD1; IBDIMDE; LAP; TGF-beta1; TGFB; TGFbeta |
| Locus ID | 7040 |
| UniProt ID | P01137, A0A499FJK2 |
| Cytogenetics | 19q13.2 |
| Summary | 'This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGFB family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease. [provided by RefSeq, Aug 2016]' |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transcription Factors |
| Protein Pathways | Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Cytokine-cytokine receptor interaction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma, TGF-beta signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| TP300973 | Recombinant protein of human transforming growth factor, beta 1 (TGFB1) |
USD 823.00 |
|
| TP720760 | Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1) |
USD 330.00 |
|
| TP723438 | Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1). |
USD 240.00 |
|
| TP723439 | Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1). |
USD 240.00 |
|
| TP723781 | Purified recombinant protein of Human transforming growth factor, beta 1 (TGFB1) |
USD 370.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China