SF3B5 (NM_031287) Human Mass Spec Standard

CAT#: PH300977

SF3B5 MS Standard C13 and N15-labeled recombinant protein (NP_112577)

Product Images

Coomassie blue staining of purified SF3B5 protein (Cat# TP300977). The protein was produced from HEK293T cells transfected with SF3B5 cDNA clone (Cat# RC200977) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200977
• Predicted MW: 10.1 kDa
• Protein Sequence:
  Sequence Link

  >RC200977 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLME
  KMLQPCGPPADKPEEN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_112577
• RefSeq Size: 786
• RefSeq ORF: 258
• Synonyms: SF3b10; Ysf3
• Locus ID: 83443
• UniProt ID: Q9BWJ5
• Cytogenetics: 6q24.2
• Protein Pathways: Spliceosome