POLR3GL (NM_032305) Human Mass Spec Standard
CAT#: PH300991
POLR3GL MS Standard C13 and N15-labeled recombinant protein (NP_115681)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200991 |
Predicted MW | 25.3 kDa |
Protein Sequence |
>RC200991 protein sequence
Red=Cloning site Green=Tags(s) MASRGGGRGRGRGQLTFNVEAVGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGA MRQLPYFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPRELKIRVRKLQKERITILLPKRPPKT TEDKEETIQKLETLEKKEEEVTSEEDEEKEEEEEKEEEEEEEYDEEEHEEETDYIMSYFDNGEDFGGDSD DNMDEAIY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115681 |
RefSeq Size | 1191 |
RefSeq ORF | 654 |
Synonyms | flj32422; RPC32HOM |
Locus ID | 84265 |
UniProt ID | Q9BT43 |
Cytogenetics | 1q21.1 |
Summary | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. [UniProtKB/Swiss-Prot Function] |
Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410247 | POLR3GL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410247 | Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like (POLR3GL) |
USD 396.00 |
|
TP300991 | Recombinant protein of human polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like (POLR3GL) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review