MSI2 (NM_138962) Human Mass Spec Standard

CAT#: PH301003

MSI2 MS Standard C13 and N15-labeled recombinant protein (NP_620412)

Product Images

Coomassie blue staining of purified MSI2 protein (Cat# TP301003). The protein was produced from HEK293T cells transfected with MSI2 cDNA clone (Cat# RC201003) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201003
• Predicted MW: 35.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201003 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFA
  DPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAM
  LMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAF
  MLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPG
  PVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGYH
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620412
• RefSeq Size: 1581
• RefSeq ORF: 984
• Synonyms: MSI2H
• Locus ID: 124540
• UniProt ID: Q96DH6
• Cytogenetics: 17q22
• Summary: This gene encodes an RNA-binding protein that is a member of the Musashi protein family. The encoded protein is transcriptional regulator that targets genes involved in development and cell cycle regulation. Mutations in this gene are associated with poor prognosis in certain types of cancers. This gene has also been shown to be rearranged in certain cancer cells. [provided by RefSeq, Apr 2016]