PSMC3IP (NM_013290) Human Mass Spec Standard

CAT#: PH301045

PSMC3IP MS Standard C13 and N15-labeled recombinant protein (NP_037422)

Product Images

Coomassie blue staining of purified PSMC3IP protein (Cat# TP301045). The protein was produced from HEK293T cells transfected with PSMC3IP cDNA clone (Cat# RC201045) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201045
• Predicted MW: 23.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201045 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKI
  YFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAEMQKEIQELKKECAGYRERLKNIKAATN
  HVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037422
• RefSeq Size: 1440
• RefSeq ORF: 615
• Synonyms: GT198; HOP2; HUMGT198A; ODG3; TBPIP
• Locus ID: 29893
• UniProt ID: Q9P2W1
• Cytogenetics: 17q21.2
• Summary: This gene encodes a protein that functions in meiotic recombination. It is a subunit of the PSMC3IP/MND1 complex, which interacts with PSMC3/TBP1 to stimulate DMC1- and RAD51-mediated strand exchange during meiosis. The protein encoded by this gene can also co-activate ligand-driven transcription mediated by estrogen, androgen, glucocorticoid, progesterone, and thyroid nuclear receptors. Mutations in this gene cause XX female gonadal dysgenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2011]
• Protein Families: Druggable Genome