CEP55 (NM_018131) Human Mass Spec Standard
CAT#: PH301052
CEP55 MS Standard C13 and N15-labeled recombinant protein (NP_060601)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201052 |
Predicted MW | 54.1 kDa |
Protein Sequence |
>RC201052 protein sequence
Red=Cloning site Green=Tags(s) MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGKLTDKERHRLLEKIRVLEAEK EKNAYQLTEKDKEIQRLRDQLKARYSTTALLEQLEETTREGERREQVLKALSEEKDVLKQQLSAATSRIA ELESKTNTLRLSQTVAPNCFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTE TAAHSLPQQTKKPESEGYLQEEKQKCYNDLLASAKKDLEVERQTITQLSFELSEFRRKYEETQKEVHNLN QLLYSQRRADVQHLEDDRHKTEKIQKLREENDIARGKLEEEKKRSEELLSQVQFLYTSLLKQQEEQTRVA LLEQQMQACTLDFENEKLDRQHVQHQLLVILKELRKARNQITQLESLKQLHEFAITEPLVTFQGETENRE KVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCSK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_060601 |
RefSeq Size | 2656 |
RefSeq ORF | 1392 |
Synonyms | C10orf3; CT111; MARCH; URCC6 |
Locus ID | 55165 |
UniProt ID | Q53EZ4 |
Cytogenetics | 10q23.33 |
Summary | Plays a role in mitotic exit and cytokinesis (PubMed:16198290, PubMed:17853893). Recruits PDCD6IP and TSG101 to midbody during cytokinesis. Required for successful completion of cytokinesis (PubMed:17853893). Not required for microtubule nucleation (PubMed:16198290). Plays a role in the development of the brain and kidney (PubMed:28264986). [UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413284 | CEP55 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426692 | CEP55 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413284 | Transient overexpression lysate of centrosomal protein 55kDa (CEP55), transcript variant 1 |
USD 396.00 |
|
LY426692 | Transient overexpression lysate of centrosomal protein 55kDa (CEP55), transcript variant 2 |
USD 396.00 |
|
TP301052 | Recombinant protein of human centrosomal protein 55kDa (CEP55), transcript variant 1 |
USD 823.00 |
|
TP761544 | Purified recombinant protein of Human centrosomal protein 55kDa (CEP55), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review