CEP55 (NM_018131) Human Recombinant Protein
CAT#: TP301052
Recombinant protein of human centrosomal protein 55kDa (CEP55), transcript variant 1
View other "CEP55" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201052 protein sequence
Red=Cloning site Green=Tags(s) MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGKLTDKERHRLLEKIRVLEAEK EKNAYQLTEKDKEIQRLRDQLKARYSTTALLEQLEETTREGERREQVLKALSEEKDVLKQQLSAATSRIA ELESKTNTLRLSQTVAPNCFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTE TAAHSLPQQTKKPESEGYLQEEKQKCYNDLLASAKKDLEVERQTITQLSFELSEFRRKYEETQKEVHNLN QLLYSQRRADVQHLEDDRHKTEKIQKLREENDIARGKLEEEKKRSEELLSQVQFLYTSLLKQQEEQTRVA LLEQQMQACTLDFENEKLDRQHVQHQLLVILKELRKARNQITQLESLKQLHEFAITEPLVTFQGETENRE KVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCSK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060601 |
Locus ID | 55165 |
UniProt ID | Q53EZ4 |
Cytogenetics | 10q23.33 |
Refseq Size | 2656 |
Refseq ORF | 1392 |
Synonyms | C10orf3; CT111; MARCH; URCC6 |
Summary | Plays a role in mitotic exit and cytokinesis (PubMed:16198290, PubMed:17853893). Recruits PDCD6IP and TSG101 to midbody during cytokinesis. Required for successful completion of cytokinesis (PubMed:17853893). Not required for microtubule nucleation (PubMed:16198290). Plays a role in the development of the brain and kidney (PubMed:28264986).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413284 | CEP55 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426692 | CEP55 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413284 | Transient overexpression lysate of centrosomal protein 55kDa (CEP55), transcript variant 1 |
USD 396.00 |
|
LY426692 | Transient overexpression lysate of centrosomal protein 55kDa (CEP55), transcript variant 2 |
USD 396.00 |
|
PH301052 | CEP55 MS Standard C13 and N15-labeled recombinant protein (NP_060601) |
USD 2,055.00 |
|
TP761544 | Purified recombinant protein of Human centrosomal protein 55kDa (CEP55), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review