STAT1 (NM_139266) Human Mass Spec Standard
CAT#: PH301075
STAT1 MS Standard C13 and N15-labeled recombinant protein (NP_644671)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201075 |
| Predicted MW | 83 kDa |
| Protein Sequence |
>RC201075 protein sequence
Red=Cloning site Green=Tags(s) MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSR FSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQK ELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKR KEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKL EELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVK LQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTP PCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIES ILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHA VEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTG YIKTELISVSEV myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_644671 |
| RefSeq Size | 2798 |
| RefSeq ORF | 2136 |
| Synonyms | CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91 |
| Locus ID | 6772 |
| UniProt ID | P42224 |
| Cytogenetics | 2q32.2 |
| Summary | 'The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. The protein encoded by this gene can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. The protein plays an important role in immune responses to viral, fungal and mycobacterial pathogens. Mutations in this gene are associated with Immunodeficiency 31B, 31A, and 31C. [provided by RefSeq, Jun 2020]' |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Chemokine signaling pathway, Jak-STAT signaling pathway, Pancreatic cancer, Pathways in cancer, Toll-like receptor signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408329 | STAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC416045 | STAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429341 | STAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY408329 | Transient overexpression lysate of signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant beta |
USD 436.00 |
|
| LY416045 | Transient overexpression lysate of signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant alpha |
USD 665.00 |
|
| LY429341 | Transient overexpression lysate of signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant alpha |
USD 605.00 |
|
| PH313858 | STAT1 MS Standard C13 and N15-labeled recombinant protein (NP_009330) |
USD 2,055.00 |
|
| TP301075 | Recombinant protein of human signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant beta |
USD 867.00 |
|
| TP313858 | Recombinant protein of human signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant alpha |
USD 748.00 |
|
| TP720884 | Purified recombinant protein of Human signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant beta |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China