DNAJB2 (NM_006736) Human Mass Spec Standard

CAT#: PH301081

DNAJB2 MS Standard C13 and N15-labeled recombinant protein (NP_006727)

Product Images

Coomassie blue staining of purified DNAJB2 protein (Cat# TP301081). The protein was produced from HEK293T cells transfected with DNAJB2 cDNA clone (Cat# RC201081) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201081
• Predicted MW: 35.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201081 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGR
  EGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDLGPFSELQNRGSRHSGPFFTF
  SSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRITTRRIMENGQERVEVEEDGQLKSVTINGVPD
  DLALGLELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQ
  HRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASRCLIL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006727
• RefSeq Size: 3129
• RefSeq ORF: 972
• Synonyms: CMT2T; DSMA5; HSJ-1; HSJ1; HSPF3
• Locus ID: 3300
• UniProt ID: P25686
• Cytogenetics: 2q35
• Summary: 'This gene is almost exclusively expressed in the brain, mainly in the neuronal layers. It encodes a protein that shows sequence similarity to bacterial DnaJ protein and the yeast homologs. In bacteria, this protein is implicated in protein folding and protein complex dissociation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2011]'