TOMM34 (NM_006809) Human Mass Spec Standard

CAT#: PH301083

TOMM34 MS Standard C13 and N15-labeled recombinant protein (NP_006800)

Product Images

Coomassie blue staining of purified TOMM34 protein (Cat# TP301083). The protein was produced from HEK293T cells transfected with TOMM34 cDNA clone (Cat# RC201083) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201083
• Predicted MW: 34.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201083 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDC
  IKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEW
  RLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHK
  KAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSS
  FADISNLLQIEPRNGPAQKLRQEVKQNLH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006800
• RefSeq Size: 2066
• RefSeq ORF: 927
• Synonyms: HTOM34P; TOM34; URCC3
• Locus ID: 10953
• UniProt ID: Q15785
• Cytogenetics: 20q13.12
• Summary: The protein encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome