AMSH (STAMBP) (NM_201647) Human Mass Spec Standard
CAT#: PH301090
STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_964010)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201090 |
| Predicted MW | 48.1 kDa |
| Protein Sequence |
>RC201090 protein sequence
Red=Cloning site Green=Tags(s) MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLF IEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQ ELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPT LTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVE TCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLH THCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI TDLR myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_964010 |
| RefSeq Size | 6277 |
| RefSeq ORF | 1272 |
| Synonyms | AMSH; MICCAP |
| Locus ID | 10617 |
| UniProt ID | O95630, A0A140VK54 |
| Cytogenetics | 2p13.1 |
| Summary | Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403869 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC404497 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC416628 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC431018 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403869 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 3 |
USD 665.00 |
|
| LY404497 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 2 |
USD 436.00 |
|
| LY416628 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 1 |
USD 436.00 |
|
| LY431018 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 3 |
USD 396.00 |
|
| PH309475 | STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_006454) |
USD 2,055.00 |
|
| PH317643 | STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_998787) |
USD 2,055.00 |
|
| TP301090 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 2 |
USD 867.00 |
|
| TP309475 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 1 |
USD 823.00 |
|
| TP317643 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China