ASS1 (NM_054012) Human Mass Spec Standard
CAT#: PH301130
ASS1 MS Standard C13 and N15-labeled recombinant protein (NP_446464)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201130 |
| Predicted MW | 46.5 kDa |
| Protein Sequence |
>RC201130 protein sequence
Red=Cloning site Green=Tags(s) MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVE EFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIK VIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKT QDPAKAPNTPDILEIEFKKGVPVKVTNVKDGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRG IYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQ VSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_446464 |
| RefSeq Size | 1801 |
| RefSeq ORF | 1236 |
| Synonyms | ASS; CTLN1 |
| Locus ID | 445 |
| UniProt ID | P00966, Q5T6L4 |
| Cytogenetics | 9q34.11 |
| Summary | 'The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of this gene cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2012]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403289 | ASS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC424955 | ASS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403289 | Transient overexpression lysate of argininosuccinate synthetase 1 (ASS1), transcript variant 2 |
USD 436.00 |
|
| LY424955 | Transient overexpression lysate of argininosuccinate synthetase 1 (ASS1), transcript variant 1 |
USD 436.00 |
|
| PH323189 | ASS1 MS Standard C13 and N15-labeled recombinant protein (NP_000041) |
USD 2,055.00 |
|
| TP301130 | Recombinant protein of human argininosuccinate synthetase 1 (ASS1), transcript variant 2 |
USD 823.00 |
|
| TP323189 | Recombinant protein of human argininosuccinate synthetase 1 (ASS1), transcript variant 1 |
USD 823.00 |
|
| TP720522 | Recombinant protein of human argininosuccinate synthetase 1 (ASS1), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China