TPM4 (NM_003290) Human Mass Spec Standard
CAT#: PH301133
TPM4 MS Standard C13 and N15-labeled recombinant protein (NP_003281)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201133 |
Predicted MW | 28.6 kDa |
Protein Sequence |
>RC201133 protein sequence
Red=Cloning site Green=Tags(s) MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLFEEELDRAQERL ATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGEL ERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTV AKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003281 |
RefSeq Size | 2645 |
RefSeq ORF | 744 |
Synonyms | HEL-S-108 |
Locus ID | 7171 |
UniProt ID | P67936, V9HW56 |
Cytogenetics | 19p13.12-p13.11 |
Summary | 'This gene encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosins are dimers of coiled-coil proteins that polymerize end-to-end along the major groove in most actin filaments. They provide stability to the filaments and regulate access of other actin-binding proteins. In muscle cells, they regulate muscle contraction by controlling the binding of myosin heads to the actin filament. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2009]' |
Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418787 | TPM4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428735 | TPM4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418787 | Transient overexpression lysate of tropomyosin 4 (TPM4), transcript variant 2 |
USD 396.00 |
|
LY428735 | Transient overexpression lysate of tropomyosin 4 (TPM4), transcript variant 1 |
USD 396.00 |
|
PH327534 | TPM4 MS Standard C13 and N15-labeled recombinant protein (NP_001138632) |
USD 2,055.00 |
|
TP301133 | Recombinant protein of human tropomyosin 4 (TPM4), transcript variant 2 |
USD 439.00 |
|
TP327534 | Purified recombinant protein of Homo sapiens tropomyosin 4 (TPM4), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review