TPM4 (NM_003290) Human Mass Spec Standard

CAT#: PH301133

TPM4 MS Standard C13 and N15-labeled recombinant protein (NP_003281)

Product Images

Coomassie blue staining of purified TPM4 protein (Cat# TP301133). The protein was produced from HEK293T cells transfected with TPM4 cDNA clone (Cat# RC201133) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201133
• Predicted MW: 28.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201133 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLFEEELDRAQERL
  ATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGEL
  ERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTV
  AKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003281
• RefSeq Size: 2645
• RefSeq ORF: 744
• Synonyms: HEL-S-108
• Locus ID: 7171
• UniProt ID: P67936, V9HW56
• Cytogenetics: 19p13.12-p13.11
• Summary: 'This gene encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosins are dimers of coiled-coil proteins that polymerize end-to-end along the major groove in most actin filaments. They provide stability to the filaments and regulate access of other actin-binding proteins. In muscle cells, they regulate muscle contraction by controlling the binding of myosin heads to the actin filament. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2009]'
• Protein Pathways: Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)