Protein Phosphatase 1 beta (PPP1CB) (NM_206876) Human Mass Spec Standard

CAT#: PH301142

PPP1CB MS Standard C13 and N15-labeled recombinant protein (NP_996759)

Product Images

Coomassie blue staining of purified PPP1CB protein (Cat# TP301142). The protein was produced from HEK293T cells transfected with PPP1CB cDNA clone (Cat# RC201142) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201142
• Predicted MW: 37.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201142 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD
  LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECK
  RRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDK
  DVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGG
  MMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_996759
• RefSeq Size: 4786
• RefSeq ORF: 981
• Synonyms: HEL-S-80p; NSLH2; PP-1B; PP1B; PP1beta; PPP1CD
• Locus ID: 5500
• UniProt ID: P62140, V9HW04
• Cytogenetics: 2p23.2
• Summary: 'The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: Focal adhesion, Insulin signaling pathway, Long-term potentiation, Oocyte meiosis, Regulation of actin cytoskeleton, Vascular smooth muscle contraction