FVT1 (KDSR) (NM_002035) Human Mass Spec Standard

CAT#: PH301153

KDSR MS Standard C13 and N15-labeled recombinant protein (NP_002026)

Product Images

Coomassie blue staining of purified KDSR protein (Cat# TP301153). The protein was produced from HEK293T cells transfected with KDSR cDNA clone (Cat# RC201153) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201153
• Predicted MW: 36.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201153 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLL
  QAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFER
  LMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVY
  ITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCG
  MAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002026
• RefSeq Size: 5198
• RefSeq ORF: 996
• Synonyms: DHSR; EKVP4; FVT1; SDR35C1
• Locus ID: 2531
• UniProt ID: Q06136, A0A024R292
• Cytogenetics: 18q21.33
• Summary: 'The protein encoded by this gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Metabolic pathways, Sphingolipid metabolism